Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0139400_circ_g.3 |
ID in PlantcircBase | osa_circ_032726 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 2080634-2081207 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0139400 |
Parent gene annotation |
NAD(P)-binding domain containing protein. (Os07t0139400-01);NAD( P)-binding domain containing protein. (Os07t0139400-02);Similar to UDP-D-xylose epimerase 1. (Os07t0139400-03) |
Parent gene strand | + |
Alternative splicing | Os07g0139400_circ_g.4 Os07g0139400_circ_g.5 Os07g0139400_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0139400-02:2 Os07t0139400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.146783841 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2080735-2081122(+) 2080663-2081172(-) |
Potential amino acid sequence |
MLPTNRNRPQQRPARSWYFISDMDFSDPKRKPRYLSKILMVALLTAMCVVMLTQPPCHRRTPSV VAGSEQEESSLAFLSPRNFDSFWEGIWCAAAAPDASHQQEQAPAEACQILVFHLRHGLLRSEAQ AAVPQ*(+) MIPPAHCRPPHWESSYGRAAV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |