Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0197200_circ_g.4 |
| ID in PlantcircBase | osa_circ_013654 |
| Alias | NA, |
| Organism | Oryza sativa |
| Position | chr2: 5444834-5445220 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, CIRI-long |
| Parent gene | Os02g0197125 |
| Parent gene annotation |
Hypothetical protein. (Os02t0197125-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0197200_circ_g.2 Os02g0197200_circ_g.3 Os02g0197200_circ_g.5 Os02g0197200_circ_g.6 Os02g0197200_circ_g.7 Os02g0197200_circ_g.8 Os02g0197200_circ_g.9 Os02g0197200_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0197200-01:3 Os02t0197125-00:2 Os02t0197200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.195466193 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5445039-5444856(+) 5445219-5444856(+) 5444842-5445003(-) |
| Potential amino acid sequence |
MVRALEHDFKEVVGISWYLWLFVIVFLLLNINDLILEAVL*(+) MISFLKQFYDSVGKPDYQVLRSAFVQRHYPNRPDFDFHKYMVRALEHDFKEVVGISWYLWLFVI VFLLLNINDLILEAVL*(+) MRSFIFSSRKTITKSHRYQLIPTTSLKSCSRARTMYLWKSKSGRFG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017; this study |