Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0197200_circ_g.4 |
ID in PlantcircBase | osa_circ_013654 |
Alias | NA, |
Organism | Oryza sativa |
Position | chr2: 5444834-5445220 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, CIRI-long |
Parent gene | Os02g0197125 |
Parent gene annotation |
Hypothetical protein. (Os02t0197125-00) |
Parent gene strand | - |
Alternative splicing | Os02g0197200_circ_g.2 Os02g0197200_circ_g.3 Os02g0197200_circ_g.5 Os02g0197200_circ_g.6 Os02g0197200_circ_g.7 Os02g0197200_circ_g.8 Os02g0197200_circ_g.9 Os02g0197200_circ_g.10 |
Support reads | 1 |
Tissues | shoot, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0197200-01:3 Os02t0197125-00:2 Os02t0197200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.195466193 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5445039-5444856(+) 5445219-5444856(+) 5444842-5445003(-) |
Potential amino acid sequence |
MVRALEHDFKEVVGISWYLWLFVIVFLLLNINDLILEAVL*(+) MISFLKQFYDSVGKPDYQVLRSAFVQRHYPNRPDFDFHKYMVRALEHDFKEVVGISWYLWLFVI VFLLLNINDLILEAVL*(+) MRSFIFSSRKTITKSHRYQLIPTTSLKSCSRARTMYLWKSKSGRFG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017; this study |