Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0791800_circ_g.1 |
ID in PlantcircBase | osa_circ_016876 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 33630283-33630614 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0791800 |
Parent gene annotation |
WD-40 repeat containing protein. (Os02t0791800-01);WD-40 repeat containing protein. (Os02t0791800-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0791800-01:2 Os02t0791800-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.270406827 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33630500-33630286(+) 33630516-33630365(+) 33630502-33630364(-) |
Potential amino acid sequence |
MCNEPDELVATRTSGRSSDGPNESEYIVDGYVPRRKLCDS*(+) MNLWQQEHRADHPMVRMRVNILLMGMFPAENCVTLDSCRDDVVNNVMVCWIQSTSYCSRNH*(+ ) MFFLDAARNRRNQTSKLLGSMIPGAITRALDPANHHIIHNVIPAGIKSHTVFGGEHTHQQYIHS HSDHRMICPMFLLPQVHQARCTCFSSMLPEIEGTKRANCLVQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |