Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0194800_circ_g.4 |
| ID in PlantcircBase | osa_circ_033119 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 5130363-5131194 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0194800 |
| Parent gene annotation |
Similar to galactosyltransferase/ transferase, transferring hexo syl groups. (Os07t0194800-01);Similar to Galactosyltransferase/ transferase, transferring hexosyl groups. (Os07t0194800-02) |
| Parent gene strand | - |
| Alternative splicing | Os07g0194800_circ_g.1 Os07g0194800_circ_g.2 Os07g0194800_circ_g.3 |
| Support reads | 2 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0194800-02:3 Os07t0194800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017619 |
| PMCS | 0.511940284 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5131081-5130376(+) 5131131-5131128(-) |
| Potential amino acid sequence |
MCTSFGLPIRRFTHHFIFDSSDFLSSSRIHFSHLSWPSTHTQQ*(+) MKWWVKRLIGRPKDVHISWPYPFAEGKLFVLTLTAGLEGYHVNVDGRHVTSFPYRTGYTLEDAT GLSLNGDIDIESIFASSLPNSHPSFAPERYLEMSEQWRAPPLPTEPVELFIGILSAASHFAERM AVRKSWMMYTRKSTNIVARFFVALNGKKEVNAELKREAEFFQDIVIVPFMDSYDLVVLKTIAIA EYGLMANLSVRNGFVTTTRSLRNRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |