Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d003203_circ_g.5 |
| ID in PlantcircBase | zma_circ_007150 |
| Alias | Zm02circ00039, GRMZM2G080176_C2 |
| Organism | Zea mays |
| Position | chr2: 35531493-35532251 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d003203 |
| Parent gene annotation |
DNA-directed RNA polymerase III subunit 1 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d003203_circ_g.4 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d003203_T002:2 Zm00001d003203_T004:2 Zm00001d003203_T015:2 Zm00001d003203_T009:2 Zm00001d003203_T007:2 Zm00001d003203_T001:2 Zm00001d003203_T013:2 Zm00001d003203_T005:2 Zm00001d003203_T011:2 Zm00001d003203_T003:2 Zm00001d003203_T006:2 Zm00001d003203_T012:2 Zm00001d003203_T014:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141309972 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35532189-35531512(+) 35531678-35531504(+) 35531591-35532240(-) 35531680-35532137(-) |
| Potential amino acid sequence |
MFSWLDIVHTNGKTMVPYKSCMQGSLNL*(+) MHTFPAIDLISFNTPVMLCSSVWAALQPGCNASAPFANKEIRSWHFLYPPSISFFFCRFRCSPG WTSSTPMEKPWFPINLACRGL*(+) MCWTAISWRASCPRWFSKQNSSSLSYKFKDPCMQDL*(-) MDTLHWRNSPLIMSQCGSKGSPINISQMVACVGQQSVGGRRAPDGFLNRTLPHFPINSKTPACK IYREPWFFHWCGRCPTRRTSKSAKEKGNRRRVQKMP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |