Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0187700_circ_g.2 |
ID in PlantcircBase | osa_circ_033063 |
Alias | Os07circ04013/Os_ciR880 |
Organism | Oryza sativa |
Position | chr7: 4684319-4685745 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os07g0187700 |
Parent gene annotation |
WD40 protein, Regulation of the plasma membrane localization of phosphate transporters, Phosphate uptake and translocation (Os07 t0187700-01) |
Parent gene strand | + |
Alternative splicing | Os07g0187700_circ_g.1 |
Support reads | 2/37/2 |
Tissues | leaf and panicle/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0187700-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017606 |
PMCS | 0.371988087 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4684353-4684352(+) 4685674-4684368(+) 4684344-4685682(-) |
Potential amino acid sequence |
MNVLLDEPKAHKSFRDMDISLDSEFLVSTSTDGSARIWKIDEGVPLVNLTRSADEKIECCRFSR DGMKPFLFCTVAKGNKVVTVVWNISDWSRIGYKRLLGKPISTLSVSMDGKYLALGSHDGDFCAV DVKKMDVSHWSKKVHLGSPVSSIEFCPTERMGISEYFIGRA*(+) MFLTGARRSILVLRFPQLNFVLLKGWASQNISLAEHECALR*(+) MKYSEMPILSVGQNSIEETGEPRWTFLLQ*(-) |
Sponge-miRNAs | osa-miR5497 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |