Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0843800_circ_g.2 |
| ID in PlantcircBase | osa_circ_022674 |
| Alias | Os03circ32442 |
| Organism | Oryza sativa |
| Position | chr3: 35468290-35468411 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os03g0843800 |
| Parent gene annotation |
Methyl chloride transferase. (Os03t0843800-00) |
| Parent gene strand | + |
| Alternative splicing | Os03g0843800_circ_g.1 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0843800-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.338714686 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35468401-35468398(-) 35468396-35468408(-) |
| Potential amino acid sequence |
MRWNGSGGSHVKKSSATKAKKLLLPSPPSAAAAAAAECSRR*(-) MERLRRLPREEIVGDEGEEAAAPVAAVSRRRRRRRV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |