Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0808100_circ_g.3 |
| ID in PlantcircBase | osa_circ_022370 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 33785073-33785323 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0808100 |
| Parent gene annotation |
Similar to Cellulose synthase-5. (Os03t0808100-01);Similar to Ce llulose synthase BoCesA5. (Os03t0808100-02);Similar to Cellulose synthase BoCesA5. (Os03t0808100-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0808100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.120530279 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33785134-33785079(+) 33785181-33785301(-) 33785212-33785263(-) |
| Potential amino acid sequence |
MTNLTTIILRMDNIIIPPRVHAPGEHPLGNLVLMVLVAGCWIVHITSIIRINIIAFIPKYRRAP WL*(+) MMILSILSMIVVRLVIPSMTVVKSLAYISHRSLTAREPADTWG*(-) MLTWRMNSGRNDDIVHSKYDSGEIGHPKYDSGEIPRIYIPSLTHSQGARRYLGMKAMMLMRMML VM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |