Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G31960_circ_g.16 |
ID in PlantcircBase | ath_circ_016016 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 13597332-13597451 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G31960 |
Parent gene annotation |
Callose synthase 2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G31960.3:1 AT2G31960.2:1 AT2G31960.4:1 AT2G31960.1:1 AT2G31960.5:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.222915833 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13597443-13597448(+) |
Potential amino acid sequence |
MNQVIYRIKLPGPAILGEGKPENQNHSIIFTRGEGLQTIDMNQVIYRIKLPGPAILGEGKPENQ NHSIIFTRGEGLQTIDMNQVIYRIKLPGPAILGEGKPENQNHSIIFTRGEGLQTIDMNQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |