Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G102200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000714 |
| Alias | Chr07:7613108|7613282 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 7613108-7613282 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G102200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.007G102200_circ_g.2 |
| Support reads | 17 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.007G102200.3:1 Gorai.007G102200.4:1 Gorai.007G102200.2:1 Gorai.007G102200.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.761767905 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7613261-7613276(+) 7613203-7613276(+) |
| Potential amino acid sequence |
MFIQFIVGANGTIDGQGAFWWQNFHKGKLKYTRPYLIEFMYSDNIQISNLTLLNSPSWNVHPVY SRGQWYNRRSRCILVAKFPQGQIEIHPTLPNRIHVLGQYPNFQPNPSQLSIMECSSSL*(+) MYSDNIQISNLTLLNSPSWNVHPVYSRGQWYNRRSRCILVAKFPQGQIEIHPTLPNRIHVLGQY PNFQPNPSQLSIMECSSSL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |