Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0269000_circ_g.1 |
ID in PlantcircBase | osa_circ_027205 |
Alias | Os_ciR1928 |
Organism | Oryza sativa |
Position | chr5: 10800408-10802755 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os05g0269000 |
Parent gene annotation |
Hypothetical conserved gene. (Os05t0269000-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 5 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0269000-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015230 |
PMCS | 0.097626473 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10800468-10802682(-) |
Potential amino acid sequence |
MVFPVEAHLPWVCNSSAYSSIITECFCCYNIGKYMETEILEINY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |