Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0269000_circ_g.1 |
| ID in PlantcircBase | osa_circ_027205 |
| Alias | Os_ciR1928 |
| Organism | Oryza sativa |
| Position | chr5: 10800408-10802755 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0269000 |
| Parent gene annotation |
Hypothetical conserved gene. (Os05t0269000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0269000-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015230 |
| PMCS | 0.097626473 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10800468-10802682(-) |
| Potential amino acid sequence |
MVFPVEAHLPWVCNSSAYSSIITECFCCYNIGKYMETEILEINY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |