Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0859800_circ_g.3 |
| ID in PlantcircBase | osa_circ_022825 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 36288172-36288825 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0859800 |
| Parent gene annotation |
Ovarian tumour, otubain domain containing protein. (Os03t0859800 -01);Similar to cysteine-type peptidase. (Os03t0859800-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0859800_circ_g.1 Os03g0859800_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0859800-01:3 Os03t0859800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132221725 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36288471-36288797(-) 36288648-36288816(-) |
| Potential amino acid sequence |
MFQKLTGTFLLLMKPFQITKDSFTGWSCMILLSSRLKGMAIVSSSTKGRRTR*(-) MIPIPHVPKTNGDIPSVDEAFSDHQRLLHRLELYDLAELKVEGDGNCQLLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |