Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0248400_circ_g.1 |
ID in PlantcircBase | osa_circ_001033 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 8171960-8172351 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0248400 |
Parent gene annotation |
Similar to Isocitrate dehydrogenase (Fragment). (Os01t0248400-01 ) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0248400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.242487054 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8172145-8171967(+) 8172185-8171962(+) 8172324-8172321(-) |
Potential amino acid sequence |
MWKSPNGTIRNILNGTVFREPIICKNIPRLVPGIM*(+) MELFSENQSSARIFLGLYLV*(+) MIGSRKTVPFKMFLIVPFGLFHIALKLNSFTRPSSGVIVAHLMATLYQVQAEEYSCR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |