Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0736300_circ_g.1 |
ID in PlantcircBase | osa_circ_016432 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 30740043-30740445 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0736300 |
Parent gene annotation |
Membrane attack complex component/perforin/complement C9 family protein. (Os02t0736300-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0736300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165252957 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30740329-30740065(+) 30740294-30740419(-) 30740404-30740367(-) |
Potential amino acid sequence |
MLLDLRRRQRRRLILLHVDDVLAAHAQPHDHMRPILLDESPCLIQEW*(+) MRHATSALQVQGQVQDTGGLQRVRCTSSSAEASRDHHSCIKQGDSSRSMGRM*(-) MGGQDVVYVKQDKSSSLSPSEIKEHLDRLGDQLFTGTCAMPPLHCRSKDKFKIPEAFNVFDAQV AQQRLHGITTLVSSKEIHREVWDACDRGAEHGRPGRRLREAG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |