Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G281700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000415 |
| Alias | Chr04:61346913|61347781 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 61346913-61347781 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G281700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/7 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-No |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.004G281700.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.109992741 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61347773-61347760(+) 61346953-61347743(-) |
| Potential amino acid sequence |
MPKVEVERSRVPRRASSSWEEDTDIKSLEPLPVHHRHVAAASVQFQKAVKLLDSGAVRATRFLW RYPTARIMLLCYLVFVHLFLMYLLHRLQEQADDLAARELAKSLGLTNANLP*(+) MTRDEELYFSLLQPWAFCMVKVSWHW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |