Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0911200_circ_g.2 |
ID in PlantcircBase | osa_circ_005406 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 39696755-39698203 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0911200 |
Parent gene annotation |
Ribophorin II family protein. (Os01t0911200-01) |
Parent gene strand | + |
Alternative splicing | Os01g0911200_circ_g.1 Os01g0911200_circ_g.3 Os01g0911200_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0911200-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011102 |
PMCS | 0.114958834 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39697551-39696771(+) 39698202-39696771(+) |
Potential amino acid sequence |
MIAVVKNDIVKLFDTIKSYGCRYEA*(+) MDVATRLKAVIKDTNSLLELYYSVGGLLSIKEQGHNVVLPDADNTFHAIKALSQSDGRWRYDTN SAESSTFAAGIALEALSAVISLADSEVDSSMIAVVKNDIVKLFDTIKSYGCRYEA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |