Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0728500_circ_g.2 |
| ID in PlantcircBase | osa_circ_016389 |
| Alias | Os_ciR1064 |
| Organism | Oryza sativa |
| Position | chr2: 30319091-30319406 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup, find_circ |
| Parent gene | Os02g0728500 |
| Parent gene annotation |
Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor kin ase 1. (Os02t0728500-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0728500_circ_g.1 |
| Support reads | 22/8/11 |
| Tissues | root/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0728500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012240 |
| PMCS | 0.36106192 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30319395-30319296(+) 30319397-30319294(-) |
| Potential amino acid sequence |
MRACNYLKIGQVAYACGEQARKILAWSLQASDKVLR*(+) MMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEAPSQNLSGLLSASIGNLTNLEI VASSHDDQDFPQGSSRCAQELGPRLRGSLQLDHGHLLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |