Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0728500_circ_g.2 |
ID in PlantcircBase | osa_circ_016389 |
Alias | Os_ciR1064 |
Organism | Oryza sativa |
Position | chr2: 30319091-30319406 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup, find_circ |
Parent gene | Os02g0728500 |
Parent gene annotation |
Similar to BRASSINOSTEROID INSENSITIVE 1-associated receptor kin ase 1. (Os02t0728500-01) |
Parent gene strand | - |
Alternative splicing | Os02g0728500_circ_g.1 |
Support reads | 22/8/11 |
Tissues | root/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0728500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012240 |
PMCS | 0.36106192 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30319395-30319296(+) 30319397-30319294(-) |
Potential amino acid sequence |
MRACNYLKIGQVAYACGEQARKILAWSLQASDKVLR*(+) MMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEAPSQNLSGLLSASIGNLTNLEI VASSHDDQDFPQGSSRCAQELGPRLRGSLQLDHGHLLT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |