Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0270200_circ_g.1 |
| ID in PlantcircBase | osa_circ_036556 |
| Alias | Os08circ05832/Os_ciR3174 |
| Organism | Oryza sativa |
| Position | chr8: 10332230-10332771 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
| Parent gene | Os08g0270200 |
| Parent gene annotation |
Exosome-associated family protein. (Os08t0270200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/4/5 |
| Tissues | panicle/root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0270200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007635* osi_circ_017721 |
| PMCS | 0.374055796 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10332728-10332740(+) 10332377-10332742(-) 10332423-10332764(-) |
| Potential amino acid sequence |
MKMRTKIVYCWFYPEERLSLWEEKLNRFEDWDKAPLRPTTTVNTQAAARFIGHSLPHLTTDQKR SMQAISRGEGGSYSGNKRKPQPPRPNKKSVRAATEEFLAKAALELSGHNDSKVKGPIRLLSDED ED*(+) MVPCPSPQIDLTFPPTSLTSPLDKTNNTQS*(-) MNLAAACVFTVVVGRNGALSQSSNRFNFSSHKLNLSSG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |