Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0270200_circ_g.1 |
ID in PlantcircBase | osa_circ_036556 |
Alias | Os08circ05832/Os_ciR3174 |
Organism | Oryza sativa |
Position | chr8: 10332230-10332771 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, find_circ |
Parent gene | Os08g0270200 |
Parent gene annotation |
Exosome-associated family protein. (Os08t0270200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/4/5 |
Tissues | panicle/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0270200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007635* osi_circ_017721 |
PMCS | 0.374055796 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10332728-10332740(+) 10332377-10332742(-) 10332423-10332764(-) |
Potential amino acid sequence |
MKMRTKIVYCWFYPEERLSLWEEKLNRFEDWDKAPLRPTTTVNTQAAARFIGHSLPHLTTDQKR SMQAISRGEGGSYSGNKRKPQPPRPNKKSVRAATEEFLAKAALELSGHNDSKVKGPIRLLSDED ED*(+) MVPCPSPQIDLTFPPTSLTSPLDKTNNTQS*(-) MNLAAACVFTVVVGRNGALSQSSNRFNFSSHKLNLSSG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |