Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d032587_circ_g.2 |
ID in PlantcircBase | zma_circ_006808 |
Alias | zma_circ_0000428, GRMZM2G388892_C1 |
Organism | Zea mays |
Position | chr1: 231355889-231358271 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d032587 |
Parent gene annotation |
DNA-directed RNA polymerase I subunit 2 |
Parent gene strand | + |
Alternative splicing | Zm00001d032587_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d032587_T009:7 Zm00001d032587_T008:7 Zm00001d032587_T006:7 Zm00001d032587_T005:7 Zm00001d032587_T001:7 Zm00001d032587_T002:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.049100867 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
231357087-231355914(+) |
Potential amino acid sequence |
MEGFENDDYITVAEAVLKDYIFVHLENNHDKFNLLIFMLQKLYALVDQTASPDNPDALQYQEAL LPGHLFTVFLKDRLQEWLRKSKRLILEEAAKNKGFDLGNDVSNVTSPV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |