Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d032587_circ_g.2 |
| ID in PlantcircBase | zma_circ_006808 |
| Alias | zma_circ_0000428, GRMZM2G388892_C1 |
| Organism | Zea mays |
| Position | chr1: 231355889-231358271 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d032587 |
| Parent gene annotation |
DNA-directed RNA polymerase I subunit 2 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d032587_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d032587_T009:7 Zm00001d032587_T008:7 Zm00001d032587_T006:7 Zm00001d032587_T005:7 Zm00001d032587_T001:7 Zm00001d032587_T002:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.049100867 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
231357087-231355914(+) |
| Potential amino acid sequence |
MEGFENDDYITVAEAVLKDYIFVHLENNHDKFNLLIFMLQKLYALVDQTASPDNPDALQYQEAL LPGHLFTVFLKDRLQEWLRKSKRLILEEAAKNKGFDLGNDVSNVTSPV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |