Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0614100_circ_g.1 |
| ID in PlantcircBase | osa_circ_015503 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 24235668-24236957 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0614100 |
| Parent gene annotation |
Golgi-localized nucleotide sugar transporter, UDP-glucose transp orter, Modulation of cell wall biosynthesis and plant growth (Os 02t0614100-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-TC |
| Number of exons covered | Os02t0614100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.11884332 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24236939-24235776(+) 24235872-24235979(+) 24235708-24236918(-) |
| Potential amino acid sequence |
MSLRSFRGTRKAEREEVFRIATARTRQAGRRIGLTASRLEISS*(+) MAKGGGALLPMSAEAGKGNGGGGGGGDDAALFKGSAMTRRGAVAALSYMACSVLLVMFNKAALS SYNFPCANVITLLQGHQEGGERRSFPHRDRADEAGWPSDRADRVSFRNILVTSPPPESSSSWWC SSSSAAEASGGGRSGRRRWRREGGRCCRCPRRRGRATGAGAAAATMPRCSRGPP*(+) MRKTSSLSAFLVPLKERNDICTGEII*(-) |
| Sponge-miRNAs | osa-miR5073 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |