Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0424400_circ_g.4 |
| ID in PlantcircBase | osa_circ_033574 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 13743244-13743440 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0424400 |
| Parent gene annotation |
Similar to Cellulose synthase-7. (Os07t0424400-01);Similar to cD NA clone:J023086F23, full insert sequence. (Os07t0424400-02);Sim ilar to cDNA clone:J023086F23, full insert sequence. (Os07t04244 00-03);Similar to cDNA clone:J023086F23, full insert sequence. ( Os07t0424400-04);Similar to cDNA clone:J023086F23, full insert s equence. (Os07t0424400-05);Similar to Cellulose synthase-7. (Os0 7t0424400-06) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0424400-02:1 Os07t0424400-06:1 Os07t0424400-01:1 Os07t0424400-05:1 Os07t0424400-03:1 Os07t0424400-04:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.529370178 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13743313-13743303(+) |
| Potential amino acid sequence |
MLDSHFSRFHHSQEVWMRQKQKIGQISFPASVDLQYQPFHFQLLFPPVCLIFVPTAYDMNCFL* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |