Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G06880_circ_g.2 |
ID in PlantcircBase | ath_circ_020183 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 2171042-2171188 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G06880 |
Parent gene annotation |
Transducin/WD40 repeat-like superfamily protein |
Parent gene strand | - |
Alternative splicing | AT3G06880_circ_g.1 |
Support reads | 2 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G06880.5:1 AT3G06880.2:1 AT3G06880.4:1 AT3G06880.1:1 AT3G06880.3:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.170071658 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2171087-2171044(-) |
Potential amino acid sequence |
MLYSSSTYVEMSNIKELIVANKREKEIKAPTRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIK ELIVANKREKEIKAPTRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIKELIVANKREKEIKAP TRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |