Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G06880_circ_g.2 |
| ID in PlantcircBase | ath_circ_020183 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 2171042-2171188 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G06880 |
| Parent gene annotation |
Transducin/WD40 repeat-like superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT3G06880_circ_g.1 |
| Support reads | 2 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G06880.5:1 AT3G06880.2:1 AT3G06880.4:1 AT3G06880.1:1 AT3G06880.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170071658 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2171087-2171044(-) |
| Potential amino acid sequence |
MLYSSSTYVEMSNIKELIVANKREKEIKAPTRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIK ELIVANKREKEIKAPTRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIKELIVANKREKEIKAP TRSWRLQNKPINSVVVYKDMLYSSSTYVEMSNIK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |