Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0236800_circ_g.1 |
| ID in PlantcircBase | osa_circ_000994 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 7579506-7579921 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0236800 |
| Parent gene annotation |
Similar to predicted protein. (Os01t0236800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0236800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002707 |
| PMCS | 0.251802724 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7579867-7579512(+) 7579892-7579897(-) 7579515-7579897(-) |
| Potential amino acid sequence |
MTSLATYPSPQVPIEVEGSLS*(+) MDKLPDLSYMDRYQRRNKEYISLGCDILPILKGRSPMQAYSDFMRSFRDAFKEYLGAIVTEVQI GMGPGGELRYPSCPTETLSQAGISSELGEFQCYDKDPSTSMGT*(-) MTRIPLPQWVLEEMDKLPDLSYMDRYQRRNKEYISLGCDILPILKGRSPMQAYSDFMRSFRDAF KEYLGAIVTEVQIGMGPGGELRYPSCPTETLSQAGISSELGEFQCYDKDPSTSMGT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |