Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0656500_circ_g.5 |
ID in PlantcircBase | osa_circ_015828 |
Alias | Os02circ20414 |
Organism | Oryza sativa |
Position | chr2: 26522136-26522278 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0656500 |
Parent gene annotation |
DnaJ-like protein. (Os02t0656500-01);Similar to DnaJ-like protei n. (Os02t0656500-02) |
Parent gene strand | + |
Alternative splicing | Os02g0656500_circ_g.1 Os02g0656500_circ_g.2 Os02g0656500_circ_g.3 Os02g0656500_circ_g.4 Os02g0656500_circ_g.6 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0656500-02:1 Os02t0656500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.425637995 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26522218-26522136(+) 26522142-26522141(+) 26522241-26522217(-) |
Potential amino acid sequence |
MLRRECNMAKRLYSRVKLMKL*(+) MISDKDKCPSCKGNKVVQQKKVLEVHVEKGMQHGQKIVFQGEADEAVR*(+) MLHSLLNMNLQDLLLLDYFVSLTTRAFILVTYHLTASSASPWNTIFWPCCIPFST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |