Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0656500_circ_g.5 |
| ID in PlantcircBase | osa_circ_015828 |
| Alias | Os02circ20414 |
| Organism | Oryza sativa |
| Position | chr2: 26522136-26522278 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0656500 |
| Parent gene annotation |
DnaJ-like protein. (Os02t0656500-01);Similar to DnaJ-like protei n. (Os02t0656500-02) |
| Parent gene strand | + |
| Alternative splicing | Os02g0656500_circ_g.1 Os02g0656500_circ_g.2 Os02g0656500_circ_g.3 Os02g0656500_circ_g.4 Os02g0656500_circ_g.6 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0656500-02:1 Os02t0656500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.425637995 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26522218-26522136(+) 26522142-26522141(+) 26522241-26522217(-) |
| Potential amino acid sequence |
MLRRECNMAKRLYSRVKLMKL*(+) MISDKDKCPSCKGNKVVQQKKVLEVHVEKGMQHGQKIVFQGEADEAVR*(+) MLHSLLNMNLQDLLLLDYFVSLTTRAFILVTYHLTASSASPWNTIFWPCCIPFST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |