Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0573000_circ_g.1 |
| ID in PlantcircBase | osa_circ_012080 |
| Alias | Os_ciR2842 |
| Organism | Oryza sativa |
| Position | chr12: 23618833-23619340 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os12g0573000 |
| Parent gene annotation |
Domain of unknown function DUF304l domain containing protein. (O s12t0573000-01);Hypothetical conserved gene. (Os12t0573000-02) |
| Parent gene strand | + |
| Alternative splicing | Os12g0573000_circ_g.2 Os12g0573000_circ_g.3 |
| Support reads | 4/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0573000-01:1 Os12t0573000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211108924 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23618933-23619337(+) 23618849-23618835(-) |
| Potential amino acid sequence |
MSSVPPLGDLILEKLDEVEISVKAVLVHLLNTSNLNLSRKAYVHDDQQSTSSKPITMSSVPPLG DLILEKLDEVEISVKAVLVHLLNTSNLNLSRKAYVHDDQQSTSSKPITMSSVPPLGDLILEKLD EVEISVKAVLVHLLNTSNLNLSRKAYVHDDQQSTSSKPITMSSVPPLGDLILEKLDEVEISVK( +) MDKNSLHRDFNFVKLLKYQISKRRNRRHSYRFRTRALLIIVYISFSTEIQIACIQKMDKNSLHR DFNFVKLLKYQISKRRNRRHSYRFRTRALLIIVYISFSTEIQIACIQKMDKNSLHRDFNFVKLL KYQISKRRNRRHSYRFRTRALLIIVYISFSTEIQIACIQKMDKNS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |