Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G61000_circ_g.4 |
| ID in PlantcircBase | ath_circ_008251 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 22472954-22473133 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE |
| Parent gene | AT1G61000 |
| Parent gene annotation |
Kinetochore protein |
| Parent gene strand | - |
| Alternative splicing | 1_circ_ag.4 AT1G61000_circ_g.1 AT1G61000_circ_g.2 AT1G61000_circ_g.3 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G61000.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168098704 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22473014-22472956(-) |
| Potential amino acid sequence |
MSLRATFQKMREKSTQMDNELNAEIGEFDEAVERDLPFVQELEANIEQLNKKILELNNQQMSLR ATFQKMREKSTQMDNELNAEIGEFDEAVERDLPFVQELEANIEQLNKKILELNNQQMSLRATFQ KMREKSTQMDNELNAEIGEFDEAVERDLPFVQELEANIEQLNKKILELNNQQMSLRATFQKMRE KSTQMDNE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |