Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_03G228200_circ_g.3 |
| ID in PlantcircBase | gma_circ_000708 |
| Alias | Gm03circRNA1803 |
| Organism | Glycine max |
| Position | chr3: 43030879-43031460 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_03G228200 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_03G228200_circ_g.2 |
| Support reads | NA |
| Tissues | stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH68394:3 KRH68395:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.235416538 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43031453-43030956(+) 43031042-43031445(-) |
| Potential amino acid sequence |
MMFLPVTFFSNWNISVVSFEVLWVNTTKN*(+) MVEQKLISEKVFSFWLNGDPNAKKGGELVFGGVDPKHFKGNHTYVPITEKGYWQEHHVK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |