Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0209600_circ_g.5 |
| ID in PlantcircBase | osa_circ_018446 |
| Alias | Os_ciR9098 |
| Organism | Oryza sativa |
| Position | chr3: 5727732-5727860 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0209600 |
| Parent gene annotation |
Similar to MEtRS (EC 6.1.1.10). (Os03t0209600-01);Similar to pre dicted protein. (Os03t0209600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0209600-02:1 Os03t0209600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.295224031 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5727757-5727857(+) 5727858-5727844(+) |
| Potential amino acid sequence |
MRIIAIALSPITPSLSLRIYTQLGFTEDQFRTLRWDLVIILETMRIIAIALSPITPSLSLRIYT QLGFTEDQFRTLRWDLVIILETMRIIAIALSPITPSLSLRIYTQLGFTEDQFRTLRWDLVIILE TMRIIAIALSPITPSLSLRIYTQLGFTEDQFRTLRW(+) MGSCYYFGDYENNCNCTITDHPKPFFEDLYTAWFHRRPI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |