Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0497700_circ_g.3 |
| ID in PlantcircBase | osa_circ_039698 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 19247824-19249630 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | Os09g0497700 |
| Parent gene annotation |
Autophagy protein 16 domain containing protein. (Os09t0497700-01 ) |
| Parent gene strand | + |
| Alternative splicing | Os09g0497700_circ_g.2 Os09g0497700_circ_g.4 |
| Support reads | 4 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0497700-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104918106 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19249600-19247869(+) 19247829-19249378(-) |
| Potential amino acid sequence |
MSGLPHCSWRRHQRNQFRQRNGPSHM*(+) MPSPTTMWQTRHDQNPTYMVYLSACRRLCFRWPWLALTFRVAFFFFLEQNVSTRTL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |