Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0579550_circ_g.1 |
| ID in PlantcircBase | osa_circ_020532 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 21239317-21239832 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0579550 |
| Parent gene annotation |
Hypothetical gene. (Os03t0579550-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0579300-00:2 Os03t0579550-00:2 Os03t0579300-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.715102762 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21239504-21239317(+) 21239582-21239579(-) |
| Potential amino acid sequence |
MIHVLVNLLGLTILAQQTPEHTHPPHPQDLGGEPSLPGTPTLTIARVTSLLLGLMGSPCTGPGV NLLGLLDNEPILDQLTDVLT*(+) MRRMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNMFKNKRVLMESIHKSKAEKAREKTLSDQF EAKRAKSKASRERKIARRDERLAQVRTSVSWSRMGSLSRSPRRFTPGPVHGEPMRPSRRDVTLA MVSVGVPGRLGSPPRSCG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |