Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d035089_circ_g.7 |
ID in PlantcircBase | zma_circ_008880 |
Alias | Zm06circ00003 |
Organism | Zea mays |
Position | chr6: 4722093-4723298 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d035089 |
Parent gene annotation |
pleckstrin homology (PH) domain-containing protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-GC |
Number of exons covered | Zm00001d035089_T006:3 Zm00001d035089_T009:2 Zm00001d035089_T003:3 Zm00001d035089_T007:3 Zm00001d035089_T005:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.161461461 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4723235-4722099(+) 4723264-4723243(-) |
Potential amino acid sequence |
MSSISHSLSIFSNSCRMSSLTIWR*(+) MDRECDIDDILNYRTIAEQQLQESLVKSSIDTHSPGSPRSDEQLAGASQGWLNWLSLGMLGVGG TADSSSFAGVISEDIIKDIYEGTEFRPVSSAENCLKKENYYSLFVRLSISQIVTTVTSRLLVKT FYKSWKIWTENVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |