Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G204700_circ_g.1 |
| ID in PlantcircBase | gra_circ_000651 |
| Alias | Chr06:46048412|46048925 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 46048412-46048925 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G204700 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 5/5 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G204700.3:3 Gorai.006G204700.1:3 Gorai.006G204700.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000232* |
| PMCS | 0.690433949 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
46048687-46048523(+) 46048865-46048419(+) |
| Potential amino acid sequence |
MKSGPVVAQKGIKYREPEYWKFGEGNKYFRHATGQIYAISKDLATYIFVNRIILKVTMNYQRKL KCTFLQWLQSGMPISILKSTMMYM*(+) MQLDKYMQSPKTWPPISLSIESY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |