Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0177100_circ_g.3 |
| ID in PlantcircBase | osa_circ_032975 |
| Alias | Os_ciR2222 |
| Organism | Oryza sativa |
| Position | chr7: 4083130-4083660 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os07g0177100 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os07t0177100-01) ;Conserved hypothetical protein. (Os07t0177100-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0177100_circ_g.4 |
| Support reads | 6 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0177100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.333522881 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4083582-4083184(+) 4083288-4083550(-) |
| Potential amino acid sequence |
MQVNGRVKCSEYVVNLLECYCGRVLPCEGFDNPCNFPGTPFTSIG*(+) MVVNAFNDNLHKCIFSYLLIITEVSVSRTSSYALADRGKRGSGKVARIIKPFTRKDPTTVAFKK IDYIFAAFYSSINLHDQQNILFSCL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |