Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G41190_circ_g.1 |
ID in PlantcircBase | ath_circ_017745 |
Alias | AT2G41190_C1, AT2G41190_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 17169293-17169507 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT2G41190 |
Parent gene annotation |
Amino acid transporter AVT1A |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G41190.2:1 AT2G41190.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.31312108 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17169498-17169498(-) |
Potential amino acid sequence |
MAGVGLLSTPYTVKEAGWASMVILLLFAVICCYTATLMKDCFENKTGIITYPDIGEAAFGKYGR ILICLLM* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |