Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0767700_circ_g.2 |
| ID in PlantcircBase | osa_circ_016687 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 32326762-32328272 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0767700 |
| Parent gene annotation |
YbaK/aminoacyl-tRNA synthetase associated region domain containi ng protein. (Os02t0767700-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0767700_circ_g.1 Os02g0767700_circ_g.3 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0767700-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113686196 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32327884-32328203(-) |
| Potential amino acid sequence |
MSIGRQPAYVDLEASPVVGKDNPPDLADFVPSGVPNSAEPIEKVTPTNVPRQNDVPKEKTCLPV KAKPKVQNKGAEKTQSKIPTNGANVEKFVNDVFDIMSPLFLSEVSKKLNVKQEELSSIFDGFKE QATIDLESVTCCLTTTGPRFQVKTELLLPSTDK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |