Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc10g079880.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003178 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr10: 61350488-61351294 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc10g079880.1 |
| Parent gene annotation |
Eukaryotic translation initiation factor 3 subunit E |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc10g079880.1.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.481700452 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61351230-61350580(+) 61351294-61351248(-) |
| Potential amino acid sequence |
MGLQLPQVLSTLPQPRLSSPSFLSWLNRSMISVLPLSWLKKMNRLQCISHILF*(+) MMERRAEVVARLKALEEAAAPLITFLQNSSAVQELRADKQHNLQLLQERYQIGPDQIEALYQYA KFQFECGNYSGAADYLYQYRALCTNSDRSVSALWGKLAAEILMQNWDIALEELNRLKEIIDSKS FSTPLNQVQNRIWLMHWSLFIFFNHDNGRTLIIDLFNQDKNDGEESRGCGKVEST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |