Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0577100_circ_g.3 |
| ID in PlantcircBase | osa_circ_015156 |
| Alias | Os_ciR4651 |
| Organism | Oryza sativa |
| Position | chr2: 22166770-22166996 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0577100 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os02 t0577100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0577100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011904 |
| PMCS | 0.390273409 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22166924-22166923(+) 22166936-22166858(-) |
| Potential amino acid sequence |
MIPHSSKSPKKVLKKKSPRSAALTTLRLPLQAQGLSRFLARSSSWQMRHSTIPISAPVSSSPAP RDAMSPPTSTAT*(+) MGDHVAVDVGGLMASRGAGEEETGALIGMVECRICQEEDLAKNLESPCACSGSLKVVRAAERGD FFFKTFLGDLLEWGIMLRWMLGGSWRPGAPARRKRGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |