Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0577100_circ_g.3 |
ID in PlantcircBase | osa_circ_015156 |
Alias | Os_ciR4651 |
Organism | Oryza sativa |
Position | chr2: 22166770-22166996 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os02g0577100 |
Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os02 t0577100-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0577100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011904 |
PMCS | 0.390273409 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22166924-22166923(+) 22166936-22166858(-) |
Potential amino acid sequence |
MIPHSSKSPKKVLKKKSPRSAALTTLRLPLQAQGLSRFLARSSSWQMRHSTIPISAPVSSSPAP RDAMSPPTSTAT*(+) MGDHVAVDVGGLMASRGAGEEETGALIGMVECRICQEEDLAKNLESPCACSGSLKVVRAAERGD FFFKTFLGDLLEWGIMLRWMLGGSWRPGAPARRKRGR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |