Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0467200_circ_g.1 |
ID in PlantcircBase | osa_circ_014613 |
Alias | Os_ciR7702 |
Organism | Oryza sativa |
Position | chr2: 15726036-15726149 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Os02g0467200 |
Parent gene annotation |
Hypothetical protein. (Os02t0467200-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0467200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15726076-15726041(+) 15726101-15726075(+) 15726101-15726038(-) |
Potential amino acid sequence |
MKGLLPLPYDSRILSQCHCRILPLHHT*(+) MTLGFCLSVTVGFYLFITLDSFAPHTSKKR*(+) MEEEVDPSSFFASVRRETIKCDEEVKSDSDTETESESHMEEEVDPSSFFASVRRETIKCDEEVK SDSDTETESESHMEEEVDPSSFFASVRRETIKCDEEVKSDSDTETESESHMEEEVDPSSFFASV RRETIKC(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |