Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0292200_circ_g.10 |
| ID in PlantcircBase | osa_circ_001419 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 10626635-10627094 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0292200 |
| Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os01 t0292200-01);Similar to CBL-interacting protein kinase 1. (Os01t 0292200-02);Similar to CBL-interacting protein kinase 1. (Os01t0 292200-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0292200_circ_g.2 Os01g0292200_circ_g.3 Os01g0292200_circ_g.4 Os01g0292200_circ_g.5 Os01g0292200_circ_g.6 Os01g0292200_circ_g.7 Os01g0292200_circ_g.8 Os01g0292200_circ_g.9 Os01g0292200_circ_g.11 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0292200-01:3 Os01t0292200-02:3 Os01t0292200-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.315934074 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10626720-10627091(+) |
| Potential amino acid sequence |
MGFQVQRGNSKLKVMKNGRGSKNLRNPSSFLVCTEVVELGPSLYVVELKKSHGDPILYRQDASQ RKIRFTSTHSPKDLFDKIENVVTEMGFQVQRGNSKLKVMKNGRGSKNLRNPSSFLVCTEVVELG PSLYVVELKKSHGDPILYRQDASQRKIRFTSTHSPKDLFDKIENVVTEMGFQVQRGNSKLKVMK NGRGSKNLRNPSSFLVCTEVVELGPSLYVVELKKSHGDPILYRQDASQRKIRFTSTHSPKDLFD KIENVVTEMGFQVQRGNSKLKVMKNGRGSKNLRNPSSFLVCTEVVELGPSLYVVELKKSHGDPI LYRQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |