Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0809800_circ_g.6 |
| ID in PlantcircBase | osa_circ_017090 |
| Alias | Os_ciR5303 |
| Organism | Oryza sativa |
| Position | chr2: 34613750-34613902 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0809800 |
| Parent gene annotation |
Phosphate (Pi) transporter, Root-to-shoot Pi transfer (Os02t0809 800-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0809800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202615251 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34613769-34613899(+) 34613771-34613862(-) |
| Potential amino acid sequence |
MEFTACYFMAGSFRTHPYETCTSGQQYKHLAYVISFLPYFWRALQIPLLRHMEFTACYFMAGSF RTHPYETCTSGQQYKHLAYVISFLPYFWRALQIPLLRHMEFTACYFMAGSFRTHPYETCTSGQQ YKHLAYVISFLPYFWRALQIPLLRHMEFTACYFMAGSFRTHPYETCTSGQQYKHLAYVISFLPY FWRALQ(+) MCRNSGICKALQKYGRKEIT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |