Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G010000_circ_g.1 |
| ID in PlantcircBase | gra_circ_001289 |
| Alias | Chr12:1105973|1106086 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 1105973-1106086 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G010000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.012G010000_circ_g.2 |
| Support reads | 23/36 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.012G010000.2:1 Gorai.012G010000.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000269* |
| PMCS | 0.989035161 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1106033-1105975(-) |
| Potential amino acid sequence |
MRQQGAIKRERAVAYSVLKQRGWCDSLGTLEELRAKQQMRQQGAIKRERAVAYSVLKQRGWCDS LGTLEELRAKQQMRQQGAIKRERAVAYSVLKQRGWCDSLGTLEELRAKQQMRQQGAIKRERAVA YSVLKQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |