Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0920400_circ_g.3 |
| ID in PlantcircBase | osa_circ_005530 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 40187083-40187378 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0920400 |
| Parent gene annotation |
Similar to Dynamin-related protein 3A (Dynamin-like protein 2) ( Dynamin-like protein 2a). Splice isoform 2. (Os01t0920400-01);Hy pothetical conserved gene. (Os01t0920400-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0920400_circ_g.2 Os01g0920400_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0920400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.196229561 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40187343-40187105(+) 40187176-40187350(-) 40187369-40187282(-) |
| Potential amino acid sequence |
MSSFFPSTIEEKAQVRTKHS*(+) MLTLVKMLPMKTSVWLYRTQLVLGVLCSYLSFLLNGGGKK*(-) MVEGKNEDISTIELCGGARIHYIFQSIYVKSLEDVDPCEDVTDEDIRMAIQNATGPRSALFVPE LSPQWWREKMRTYQQLSFVVEQGSIIFFNLYM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |