Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Bra033886_circ_g.1 |
| ID in PlantcircBase | bra_circ_000233 |
| Alias | A05:15765520|15765770 |
| Organism | Brassica rapa |
| Position | chrA05: 15765520-15765770 JBrowse» |
| Reference genome | Brassica rapa v2 |
| Type | ie-circRNA |
| Identification method | Find_circ |
| Parent gene | Bra033886 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Bra0A33886:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_015179 |
| PMCS | 0.850263546 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15765624-15765744(-) 15765557-15765665(-) |
| Potential amino acid sequence |
MDGAPYLRKVDLKMYKSYKDLSDALAKMFSSFTMEPKWWDGHL* MLWLKCSAPLLWSPSGGMATCEELQEKHHHTAEDKWQGGGQQREGWK* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to calcium deficiency-induced tip-burn |
| Other Information | |
|---|---|
| References | Wang et al., 2019 |