Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G31070_circ_g.2 |
ID in PlantcircBase | ath_circ_005185 |
Alias | Ath_circ_FC0584 |
Organism | Arabidpsis thaliana |
Position | chr1: 11087273-11087583 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G31070 |
Parent gene annotation |
GlcNAc1pUT1 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G31070.2:2 AT1G31070.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.297793685 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11087530-11087580(+) |
Potential amino acid sequence |
MASAINQRTGRLQYCWSNVRVADPTFLGYFIDKGAASAAKVVRKAYPQEQVGVFVRRGKGGPLT VVEYSELDQSMASAINQRTGRLQYCWSNVRVADPTFLGYFIDKGAASAAKVVRKAYPQEQVGVF VRRGKGGPLTVVEYSELDQSMASAINQRTGRLQYCWSNVRVADPTFLGYFIDKGAASAAKVVRK AYPQEQVGVFVRRGKGGPLTVVEYSELDQSMASAINQRTGRLQYCWSN(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |