Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G198900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000748 |
| Alias | Chr07:20215997|20216451 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 20215997-20216451 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G198900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G198900.5:3 Gorai.007G198900.3:3 Gorai.007G198900.1:3 Gorai.007G198900.2:3 Gorai.007G198900.6:3 Gorai.007G198900.4:3 Gorai.007G198900.7:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000625* |
| PMCS | 0.678412308 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20216389-20216425(-) 20216006-20216425(-) 20216221-20216019(+) |
| Potential amino acid sequence |
MWTEAWSGWFSEFGGPLHHRPAEDLAFAVARFIQKGGSFVNYYMYHGGTNFGRTAGGPFITTSY DYDAPIDEYDKYMQWFLL*(-) MNMINTCNGFYCDSFQPNKPYKPTMWTEAWSGWFSEFGGPLHHRPAEDLAFAVARFIQKGGSFV NYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYDKYMQWFLL*(-) MPNLRLADGEVDRQTLRTIHSKLQSTLLVCRVCWVGMNHSRNHCMYLSYSSIGAS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |