Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G46630_circ_g.3 |
ID in PlantcircBase | ath_circ_042727 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 18921586-18921675 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G46630 |
Parent gene annotation |
Clathrin adaptor complexes medium subunit family protein |
Parent gene strand | + |
Alternative splicing | AT5G46630_circ_g.1 AT5G46630_circ_g.2 AT5G46630_circ_g.4 AT5G46630_circ_g.5 AT5G46630_circ_g.6 AT5G46630_circ_g.7 AT5G46630_circ_g.8 AT5G46630_circ_g.9 AT5G46630_circ_g.10 |
Support reads | 4 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G46630.2:1 AT5G46630.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.613904444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18921608-18921672(+) |
Potential amino acid sequence |
MQHYKLQVLLVGEERALLTKRMSQKTNLFQMQHYKLQVLLVGEERALLTKRMSQKTNLFQMQHY KLQVLLVGEERALLTKRMSQKTNLFQMQHYKLQVLLVGEERALLTKRM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |