Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0677800_circ_g.3 |
| ID in PlantcircBase | osa_circ_032004 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 28161539-28161703 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os06g0677800 |
| Parent gene annotation |
Similar to P-167-1_1 (Fragment). (Os06t0677800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0677800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.817556364 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28161615-28161547(+) 28161647-28161541(-) |
| Potential amino acid sequence |
MLSLDRTEDGITVCGRLARRIPRRSWLLSFLGL*(+) MPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRNDNNQLLLGIRRANRPQTVMPSSVLSSD SMHIGLLAAAAHAASTNSRFTIFYNPRNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAA AAHAASTNSRFTIFYNPRNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHIGLLAAAAHAASTNS RFTIFYNP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |