Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0409200_circ_g.4 |
| ID in PlantcircBase | osa_circ_023753 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 20242065-20242336 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0409200 |
| Parent gene annotation |
Similar to H0321H01.10 protein. (Os04t0409200-00) |
| Parent gene strand | - |
| Alternative splicing | Os04g0409200_circ_g.1 Os04g0409200_circ_igg.1 Os04g0409200_circ_igg.2 Os04g0409200_circ_g.3 |
| Support reads | 29 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0409200-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014334 |
| PMCS | 0.259857077 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20242267-20242143(+) 20242184-20242331(-) |
| Potential amino acid sequence |
MLASATAGISSSSSKGFTLLSSGIGSQDGSEILPALGQFGISSAHLLVVG*(+) MLMNQLWRINHELSHHQEMGRRYTKLTQCWKDFGTILTTDT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |