Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0409200_circ_g.4 |
ID in PlantcircBase | osa_circ_023753 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 20242065-20242336 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os04g0409200 |
Parent gene annotation |
Similar to H0321H01.10 protein. (Os04t0409200-00) |
Parent gene strand | - |
Alternative splicing | Os04g0409200_circ_g.1 Os04g0409200_circ_igg.1 Os04g0409200_circ_igg.2 Os04g0409200_circ_g.3 |
Support reads | 29 |
Tissues | shoot, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0409200-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014334 |
PMCS | 0.259857077 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20242267-20242143(+) 20242184-20242331(-) |
Potential amino acid sequence |
MLASATAGISSSSSKGFTLLSSGIGSQDGSEILPALGQFGISSAHLLVVG*(+) MLMNQLWRINHELSHHQEMGRRYTKLTQCWKDFGTILTTDT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |