Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G43300_circ_g.23 |
ID in PlantcircBase | ath_circ_025913 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 15241658-15241727 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G43300 |
Parent gene annotation |
HOPM interactor 7 |
Parent gene strand | - |
Alternative splicing | AT3G43300_circ_g.22 AT3G43300_circ_g.24 AT3G43300_circ_g.25 AT3G43300_circ_g.26 AT3G43300_circ_g.27 AT3G43300_circ_g.28 AT3G43300_circ_g.29 AT3G43300_circ_g.30 AT3G43300_circ_g.31 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G43300.3:1 AT3G43300.2:1 AT3G43300.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.164283333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15241707-15241724(+) 15241684-15241724(+) |
Potential amino acid sequence |
MLSSSMPLAKGTENKQCITLSNTHALQLDAPCKGYGKQAMHHAVQYSCSPARCPLQRVRKTSNA SRCPILMLSSSMP(+) MHHAVQYSCSPARCPLQRVRKTSNASRCPILMLSSSMPLAKGTENKQCITLSNTHALQLDAPCK GYGKQAMHHAVQYSCSPARC(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |