Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G43300_circ_g.23 |
| ID in PlantcircBase | ath_circ_025913 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 15241658-15241727 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G43300 |
| Parent gene annotation |
HOPM interactor 7 |
| Parent gene strand | - |
| Alternative splicing | AT3G43300_circ_g.22 AT3G43300_circ_g.24 AT3G43300_circ_g.25 AT3G43300_circ_g.26 AT3G43300_circ_g.27 AT3G43300_circ_g.28 AT3G43300_circ_g.29 AT3G43300_circ_g.30 AT3G43300_circ_g.31 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G43300.3:1 AT3G43300.2:1 AT3G43300.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.164283333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15241707-15241724(+) 15241684-15241724(+) |
| Potential amino acid sequence |
MLSSSMPLAKGTENKQCITLSNTHALQLDAPCKGYGKQAMHHAVQYSCSPARCPLQRVRKTSNA SRCPILMLSSSMP(+) MHHAVQYSCSPARCPLQRVRKTSNASRCPILMLSSSMPLAKGTENKQCITLSNTHALQLDAPCK GYGKQAMHHAVQYSCSPARC(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |