Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G119400_circ_g.1 |
| ID in PlantcircBase | gma_circ_007427 |
| Alias | gma-circRNA2445 |
| Organism | Glycine max |
| Position | chr17: 9424439-9425708 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_17G119400 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH03768:4 KRH03773:4 KRH03771:4 KRH03769:4 KRH03770:4 KRH03772:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.042335617 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9425426-9425689(-) |
| Potential amino acid sequence |
MGGRNTVLLDALSWRIPLVSDIPTIIFGADVTHPESGEDPCPSIAAVVASQDWPEVTKYAGLVC AQPHREELIQDLFKCWKDPHHGIVYGGMIRELLLSFKKATGQKPLRIIFYRRSQKNL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |